What is the catalog number for ALG8 Peptide - middle region?

The catalog number for ALG8 Peptide - middle region is orb2001347.

What sizes are available for ALG8 Peptide - middle region?

ALG8 Peptide - middle region is available in the following size(s): 100 µg.

Is ALG8 Peptide - middle region in stock?

ALG8 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ALG8 Peptide - middle region

Product Specifications

Product Name Alternative

CDG1H

UniProt

Q9BVK2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001007028.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KHIYLYVAPAYGVYLLRSYCFTANKPDGSIRWKSFSFVRVISLGLVVFLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-155056-SH 20 µg

V1RH1 shRNA Plasmid (m)

Sign In for Pricing

View Details

M01196-3 100 µg

Anti-Prolactin Receptor Monoclonal Antibody (U5)

Sign In for Pricing

View Details

NBP2-10178 0.1 mg

RD3 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing

View Details

51823011 1.0 µg DNA

ZNF773 ORF Vector (Human) (pORF)

Sign In for Pricing

View Details

THA35787-01 100 mg

4-[ (2,6-Difluorophenyl) methyl]piperidine hydrochloride

Sign In for Pricing

View Details

THA35787-02 1 g

4-[ (2,6-Difluorophenyl) methyl]piperidine hydrochloride

Sign In for Pricing

View Details