ZNF750 Peptide - N-terminal region
ZNF750 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ZFP750
UniProt
Q32MQ0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF750 Rabbit Polyclonal Antibody (orb577200) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_078978
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MSLLKERKPKKPHYIPRPPGKPFKYKCFQCPFTCNEKSHLFNHMKYGLCK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2354430 100 µL
MEK1 (Ser298) Recombinant Rabbit mAb, FITC conjugated
Sign In for Pricing
View Details 
11291121 3x 1.0µg DNA
ACTRT2 CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details AMM03601G 0.1mg
Monoclonal HARS Antibody (monoclonal) (M01), Clone: 1C8
Sign In for Pricing
View Details 
47803124 3x 1.0µg DNA
TRIM55 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
Sign In for Pricing
View Details