SRBD1 Peptide - C-terminal region
SRBD1 Peptide - C-terminal region
Product Specifications
UniProt
Q8N5C6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SRBD1 Rabbit Polyclonal Antibody (orb577823) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SADVEVTNEKQGKKKSKTAVNVLLKPNPLDQTCIHPESYDIAMRFLSSIG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6352143-01 0.1 mL
STMN3, CT (STMN3, SCLIP, Stathmin-3, SCG10-like protein) (MaxLight 490)
Sign In for Pricing
View Details MBS6352143-02 5x 0.1 mL
STMN3, CT (STMN3, SCLIP, Stathmin-3, SCG10-like protein) (MaxLight 490)
Sign In for Pricing
View Details 
