Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclophilin A, Mouse

Cyclophilin A protein catalyzes the isomerization of proline imide peptide bonds in oligopeptides. Cyclophilin A Protein, Mouse is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Cyclophilin A Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclophilin-a-protein-mouse-tag-free.html

Purity

95.0

Smiles

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Molecular Formula

268373 (Gene_ID) P17742 (M1-L164) (Accession)

Molecular Weight

Approximately 18.07 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGC34774 (NM_203308) Human Recombinant Protein
TP306664L 1 mg

MGC34774 (NM_203308) Human Recombinant Protein

Sign In for Pricing
View Details
KCNK4 Antibody
8C17783-AAT 50 µg

KCNK4 Antibody

Sign In for Pricing
View Details
2 Hydroxy phytanoyl CoA lyase (HACL1) Rabbit Polyclonal Antibody
TA364835 100 µL

2 Hydroxy phytanoyl CoA lyase (HACL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STUB1 Recombinant Rabbit Monoclonal Antibody [JG38-22]
ET7108-65 100 µL

STUB1 Recombinant Rabbit Monoclonal Antibody [JG38-22]

Sign In for Pricing
View Details
Band 3 (SLC4A1) (NM_000342) Human Over-expression Lysate
LY424786 100 µg

Band 3 (SLC4A1) (NM_000342) Human Over-expression Lysate

Sign In for Pricing
View Details
BactoSporeTM 488/540 Nucleic Acid Stain, 500X in DMSO, Trial Size
#40120-T 1x 20 µL

BactoSporeTM 488/540 Nucleic Acid Stain, 500X in DMSO, Trial Size

Sign In for Pricing
View Details