Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR7G2 Peptide - C-terminal region

OR7G2 Peptide - C-terminal region

Product Specifications

UniProt

Q8NG99

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR7G2 Rabbit Polyclonal Antibody (orb587634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGVYISSVVTDSPRKTAVASVMYSVFPQMVNPFIYSLRNKDMKGTLRKFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPAS1 Antibody
orb1328346 100 µg

EPAS1 Antibody

Sign In for Pricing
View Details
Scrg1 Rat shRNA Lentiviral Particle (Locus ID 64458)
TL711707V 500 µL Each

Scrg1 Rat shRNA Lentiviral Particle (Locus ID 64458)

Sign In for Pricing
View Details
EGFR/HER2/CDK9-IN-2
HY-147797 1 Each

EGFR/HER2/CDK9-IN-2

Sign In for Pricing
View Details
BAFF (B cell Activating Factor belonging to TNF Family, BLyS, TALL-1, THANK) (Biotin)
B0003-64M1 100 µg

BAFF (B cell Activating Factor belonging to TNF Family, BLyS, TALL-1, THANK) (Biotin)

Sign In for Pricing
View Details
Recombinant Human NCR3/NKp30/CD337 (C-Fc)
CG15-10ug 10 µg

Recombinant Human NCR3/NKp30/CD337 (C-Fc)

Sign In for Pricing
View Details
NDUFS8
325468-01 50 µL

NDUFS8

Sign In for Pricing
View Details