Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5P3 Peptide - C-terminal region

OR5P3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

JCG1

UniProt

Q8WZ94

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5P3 Rabbit Polyclonal Antibody (orb587642) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_703146

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYVMPKSSYSTDQNKVVSVFYTVVIPMLNPLIYSLRNKEIKGALKRELRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tle4 3'UTR Lenti-reporter-Luc Vector
46759084 1.0 µg

Tle4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MARCKS (NM_002356) Human Recombinant Protein
PH37332M5 20 µg

MARCKS (NM_002356) Human Recombinant Protein

Sign In for Pricing
View Details
Hsa-miR-5008-5p miRNA Mimic
orb1877003-01 5 nmol

Hsa-miR-5008-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-5008-5p miRNA Mimic
orb1877003-02 10 nmol

Hsa-miR-5008-5p miRNA Mimic

Sign In for Pricing
View Details
ENY2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
19331064 1.0 µg DNA

ENY2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Pig Aprotinin, Active Protein
RPU60527-01 50 µg

Pig Aprotinin, Active Protein

Sign In for Pricing
View Details