TMEM177 Peptide - C-terminal region
TMEM177 Peptide - C-terminal region
Product Specifications
UniProt
Q53S58
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM177 Rabbit Polyclonal Antibody (orb327127) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_085054
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AYACGGVEFYEKLLSGNLALRSLLGKDGEKLYTPSGNIVPRHLFRIKHLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AN301426L-01 50 µL
Recombinant Muscarinic Acetylcholine Receptor 2/CM2 Monoclonal Antibody
Sign In for Pricing
View Details AN301426L-02 100 µL
Recombinant Muscarinic Acetylcholine Receptor 2/CM2 Monoclonal Antibody
Sign In for Pricing
View Details ![Chicken IgM (Mu heavy chain specific) Mouse Monoclonal Antibody [Clone ID: M-1]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fc1cf/imageurl/am08126fc-n.webp)
AM08126FC-N 500 µg
Chicken IgM (Mu heavy chain specific) Mouse Monoclonal Antibody [Clone ID: M-1]
Sign In for Pricing
View Details ![JNK1 (MAPK8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]](https://cdn.genprice.uk/products/937/68dd1b64061270361ea13809/imageurl/ta500081bm.webp)
TA500081BM 100 µL
JNK1 (MAPK8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]
Sign In for Pricing
View Details 