Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIEF2 Peptide - N-terminal region

MIEF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MID49, SMCR7

UniProt

Q96C03

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MIEF2 Rabbit Polyclonal Antibody (orb587750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_683684

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAK3 Human Gene Knockout Kit (CRISPR)
KN417928 1 Kit

JAK3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IMPDH2 Recombinant Rabbit Monoclonal Antibody [JE40-87]
ET7109-16 100 µL

IMPDH2 Recombinant Rabbit Monoclonal Antibody [JE40-87]

Sign In for Pricing
View Details
Choline/Acetylcholine Fluorometric Assay Kit
E-BC-F055 96 T (40 samples)

Choline/Acetylcholine Fluorometric Assay Kit

Sign In for Pricing
View Details
Human PCDHB6 activation kit by CRISPRa
GA111122 1 Kit

Human PCDHB6 activation kit by CRISPRa

Sign In for Pricing
View Details
FLJ23754 Human qPCR Primer Pair (NM_152675)
HP217887 200 Reactions

FLJ23754 Human qPCR Primer Pair (NM_152675)

Sign In for Pricing
View Details
TRP1 (Tyrosinase Related Protein 1) (TA99 + TYRP1/807), CF640R conjugate, 0.1mg/mL
BNC400808-100 1x 100 µL

TRP1 (Tyrosinase Related Protein 1) (TA99 + TYRP1/807), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details