Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF74 Peptide - N-terminal region

ZNF74 Peptide - N-terminal region

Product Specifications

UniProt

Q16587

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF74 Rabbit Polyclonal Antibody (orb576622) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VISHLERGEEPWSMQREVPRGPCPEWELKAVPSQQQGICKEEPAQEPIME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NHP2L1 Rabbit Polyclonal Antibody (BF594)
orb2471489 100 µL

NHP2L1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
CD46 Peptide - middle region
orb2000025 100 µg

CD46 Peptide - middle region

Sign In for Pricing
View Details
ZN673 Antibody (C-term)
E45R31400G-1 100 µL

ZN673 Antibody (C-term)

Sign In for Pricing
View Details
DUSP1/MKP1 Antibody
DF7109-01 100 µL

DUSP1/MKP1 Antibody

Sign In for Pricing
View Details
DUSP1/MKP1 Antibody
DF7109-02 200 µL

DUSP1/MKP1 Antibody

Sign In for Pricing
View Details
Haus3 ORF Vector (Mouse) (pORF)
ORF046985 1.0 µg DNA

Haus3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details