Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD46 Peptide - middle region

CD46 Peptide - middle region

Product Specifications

Product Name Alternative

MCP, TLX, AHUS2, MIC10, TRA2.10

UniProt

P15529

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD46 Rabbit Polyclonal Antibody (orb589593) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002380.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESTIYCGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parainfluenza Virus 3 (PI3) PCR Positive Control
MBS412571-01 0.25 mL

Parainfluenza Virus 3 (PI3) PCR Positive Control

Sign In for Pricing
View Details
Parainfluenza Virus 3 (PI3) PCR Positive Control
MBS412571-02 5x 0.25 mL

Parainfluenza Virus 3 (PI3) PCR Positive Control

Sign In for Pricing
View Details
pDNR-LIB-AIM2 Plasmid
PVT28641 2 µg

pDNR-LIB-AIM2 Plasmid

Sign In for Pricing
View Details
NUDT7 Human shRNA Lentiviral Particle (Locus ID 283927)
TL321148V 500 µL Each

NUDT7 Human shRNA Lentiviral Particle (Locus ID 283927)

Sign In for Pricing
View Details
Human Glutathione Peroxidase 3, Plasma (GPX3) ELISA Kit
DLR-GPX3-Hu-96T 96 Tests

Human Glutathione Peroxidase 3, Plasma (GPX3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Burkholderia pickettii D-(-)-3-hydroxybutyrate oligomer hydrolase, partial
MBS1250247 Inquire

Recombinant Burkholderia pickettii D-(-)-3-hydroxybutyrate oligomer hydrolase, partial

Sign In for Pricing
View Details