Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGARP Peptide - C-terminal region

MGARP Peptide - C-terminal region

Product Specifications

Product Name Alternative

C4orf49, CESP-1, HUMMR, OSAP

UniProt

Q8TDB4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MGARP Rabbit Polyclonal Antibody (orb325547) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116012

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAVTIDNDKDTTKNETSDEYAELEEENSPAESESSAGDDLQEEASVGSEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhox13 Mouse Gene Knockout Kit (CRISPR)
KN514783 1 Kit

Rhox13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human APBA3 Protein (His Tag)
PKSH032064-01 10 µg

Recombinant Human APBA3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human APBA3 Protein (His Tag)
PKSH032064-02 50 µg

Recombinant Human APBA3 Protein (His Tag)

Sign In for Pricing
View Details
ADH6 Human Gene Knockout Kit (CRISPR)
KN419471 1 Kit

ADH6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AHSG Antibody
KC-1849-01 50 μL

AHSG Antibody

Sign In for Pricing
View Details
AHSG Antibody
KC-1849-02 100 µL

AHSG Antibody

Sign In for Pricing
View Details