Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF562 Peptide - C-terminal region

ZNF562 Peptide - C-terminal region

Product Specifications

UniProt

F5H1B4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF562 Rabbit Polyclonal Antibody (orb581393) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CKECGQAFTQYTGLAIHIRNHTGEKPYQCKECGKAFNRSSTLTQHRRIHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Adenosine Deaminase (ADA) ELISA Kit
BSKH61824-01 48 Tests

Human Adenosine Deaminase (ADA) ELISA Kit

Sign In for Pricing
View Details
Human Adenosine Deaminase (ADA) ELISA Kit
BSKH61824-02 96 Tests

Human Adenosine Deaminase (ADA) ELISA Kit

Sign In for Pricing
View Details
SYVN1 (NM_172230) Human Over-expression Lysate
LY406753 100 µg

SYVN1 (NM_172230) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse GPR65 Protein, His (Fc)-Avi-tagged
GPR65-3888M 50 µg

Recombinant Mouse GPR65 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
6-Thio-2'-deoxyguanosine-5'-Triphosphate
N-2045 100 mM

6-Thio-2'-deoxyguanosine-5'-Triphosphate

Sign In for Pricing
View Details
Capsule Filter, PES,0.8/0.45μm, Ster. Gr. IR, Not Sterile,450cm2,1/4"-3/8" M.Step HB, None, Bag label
CSKPS0804IN044M8NN0 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Capsule Filter, PES,0.8/0.45μm, Ster. Gr. IR, Not Sterile,450cm2,1/4"-3/8" M.Step HB, None, Bag label

Sign In for Pricing
View Details