PLGLB2 Peptide - middle region
PLGLB2 Peptide - middle region
Product Specifications
UniProt
Q02325
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLGLB2 Rabbit Polyclonal Antibody (orb587707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002656
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8120928-01 0.1 mg
Influenza A H5N2 (A/American green-winged teal/California/HKWF609/2007) Hemagglutinin Protein (HA1 Subunit)(His Tag)
Sign In for Pricing
View Details MBS8120928-02 5x 0.1 mg
Influenza A H5N2 (A/American green-winged teal/California/HKWF609/2007) Hemagglutinin Protein (HA1 Subunit)(His Tag)
Sign In for Pricing
View Details