Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDRBS3 Rabbit Polyclonal Antibody (HRP)

KHDRBS3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Etle, SALP, SLM2, SLM-2, TSTAR, T-STAR, etoile

UniProt

O75525

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KHDRBS3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTN2 (Reticulon-2, Neuroendocrine-specific Protein-like 1, NSP-like Protein 1, Neuroendocrine-specific Protein-like I, NSP-like Protein I, NSPLI, NSPL1) (MaxLight 405) discontinued
132877-ML405 100 µL

RTN2 (Reticulon-2, Neuroendocrine-specific Protein-like 1, NSP-like Protein 1, Neuroendocrine-specific Protein-like I, NSP-like Protein I, NSPLI, NSPL1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
TMEM158 Protein Vector (Mouse) (pPB-N-His)
PV239163 500 ng

TMEM158 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Himalayan Flyknit Metal Free Safety Trainers Navy size 16 - PR
SAF3315 PR

Himalayan Flyknit Metal Free Safety Trainers Navy size 16 - PR

Sign In for Pricing
View Details
Human NAV2 Knockout A549 cell line
GTR15415075 1 Vial

Human NAV2 Knockout A549 cell line

Sign In for Pricing
View Details
Lentiviral human GLP2R shRNA (UAS) - Lentiviral human GLP2R shRNA (UAS, GFP) (25)
GTR15316703 1 Vial

Lentiviral human GLP2R shRNA (UAS) - Lentiviral human GLP2R shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
DEANO (sodium)
HY-160424-01 5 mg

DEANO (sodium)

Sign In for Pricing
View Details