ZNF358 Peptide - N-terminal region
ZNF358 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ZNF358
UniProt
Q9NW07
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF358 Rabbit Polyclonal Antibody (orb583800) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005272517
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EDLNTVPEDVDPSYEDLEPVSEDLDPDAEAPGSEPQDPDPMSSSFDLDPD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH032294-01 10 µg
Recombinant Human CXCL12/SDF-1 Protein (aa19-93)
Sign In for Pricing
View Details PKSH032294-02 50 µg
Recombinant Human CXCL12/SDF-1 Protein (aa19-93)
Sign In for Pricing
View Details 
1260-AAT 2 Labelings
ReadiLink™ Rapid iFluor® 633 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*
Sign In for Pricing
View Details 
BNC941656-500 1x 500 µL
HLA-DP/-DQ/-DR (MHC II) (CR3/43), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details