Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFI Peptide - C-terminal region

CFI Peptide - C-terminal region

Product Specifications

Product Name Alternative

CFI, IF

UniProt

P05156

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFI Rabbit Polyclonal Antibody (orb587721) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000195

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD152/CTLA4 Antibody (9D9)
FMD17220 100 μg

Anti-Mouse CD152/CTLA4 Antibody (9D9)

Sign In for Pricing
View Details
Mouse TNFSF4/OX40L ELISA Kit PicoKine®
EK0858 96 Well With Removable Strips

Mouse TNFSF4/OX40L ELISA Kit PicoKine®

Sign In for Pricing
View Details
Mmu-miR-3064-5p miRNA Inhibitor
orb1870219-01 10 nmol

Mmu-miR-3064-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-3064-5p miRNA Inhibitor
orb1870219-02 20 nmol

Mmu-miR-3064-5p miRNA Inhibitor

Sign In for Pricing
View Details
TP3011
HY-135845 1 Each

TP3011

Sign In for Pricing
View Details
Recombinant human Sclerostin domain-containing protein 1
OPCA00226-100UG 100 µg

Recombinant human Sclerostin domain-containing protein 1

Sign In for Pricing
View Details