Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLCG2 Peptide - middle region

PLCG2 Peptide - middle region

Product Specifications

Product Name Alternative

PLCG2

UniProt

P16885

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLCG2 Rabbit Polyclonal Antibody (orb587945) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002652

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDMLMRIPRDGA

More Discoveries

Explore Other Products

Browse additional items from our catalog

UMPS AAV Vector (Mouse) (CMV)
49171104 1 µg

UMPS AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Recombinant Human Ketohexokinase/KHK Protein (His Tag)
PKSH032672-01 10 µg

Recombinant Human Ketohexokinase/KHK Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Ketohexokinase/KHK Protein (His Tag)
PKSH032672-02 50 µg

Recombinant Human Ketohexokinase/KHK Protein (His Tag)

Sign In for Pricing
View Details
[1-Ethyl-3- (trifluoromethyl) -1H-pyrazol-5-yl]methanol
YWB26646-01 100 mg

[1-Ethyl-3- (trifluoromethyl) -1H-pyrazol-5-yl]methanol

Sign In for Pricing
View Details
[1-Ethyl-3- (trifluoromethyl) -1H-pyrazol-5-yl]methanol
YWB26646-02 1 g

[1-Ethyl-3- (trifluoromethyl) -1H-pyrazol-5-yl]methanol

Sign In for Pricing
View Details
CrimpVial 11mm 2mL 12 x 32mm SO
CHR2544 100 / PCK

CrimpVial 11mm 2mL 12 x 32mm SO

Sign In for Pricing
View Details