Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK12 Peptide - C-terminal region

MAPK12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAPK12, ERK6, SAPK3

UniProt

P53778

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK12 Rabbit Polyclonal Antibody (orb587949) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002960

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA2L Mouse Monoclonal Antibody [Clone ID: LBI2D8]
AMM15456V 100 µL

SPATA2L Mouse Monoclonal Antibody [Clone ID: LBI2D8]

Sign In for Pricing
View Details
HBVpol655, HBV polymerase (655 - 663)
orb2694316-01 5 mg

HBVpol655, HBV polymerase (655 - 663)

Sign In for Pricing
View Details
HBVpol655, HBV polymerase (655 - 663)
orb2694316-02 10 mg

HBVpol655, HBV polymerase (655 - 663)

Sign In for Pricing
View Details
Recombinant human Podocalyxin protein
ATGP4090-050 50 µg

Recombinant human Podocalyxin protein

Sign In for Pricing
View Details
RPS6KA2 Antibody
MBS7129651-01 0.05 mL

RPS6KA2 Antibody

Sign In for Pricing
View Details
RPS6KA2 Antibody
MBS7129651-02 0.1 mL

RPS6KA2 Antibody

Sign In for Pricing
View Details