Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBPF3 Peptide - N-terminal region

NBPF3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NBPF3, L7

UniProt

Q9H094

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NBPF3 Rabbit Polyclonal Antibody (orb587843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CDQVKKEDQEATSPRLSRELLDEKEPEVLQDSLDRFYSTPFEYLELPDLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TriboTM One-Step Probe qRT-PCR (4x), 1K RXN
TBS4009-05 5 mL

TriboTM One-Step Probe qRT-PCR (4x), 1K RXN

Sign In for Pricing
View Details
DHX9 ORF Vector (Human) (pORF)
18211011 1.0 µg DNA

DHX9 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Alpha-1-Microglobulin/Bikunin Precursor (a1M) ELISA Kit
orb779396-01 48 Tests

Mouse Alpha-1-Microglobulin/Bikunin Precursor (a1M) ELISA Kit

Sign In for Pricing
View Details
Mouse Alpha-1-Microglobulin/Bikunin Precursor (a1M) ELISA Kit
orb779396-02 96 Tests

Mouse Alpha-1-Microglobulin/Bikunin Precursor (a1M) ELISA Kit

Sign In for Pricing
View Details
MAOA Rabbit Polyclonal Antibody (Cy3)
orb989906 100 µL

MAOA Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Dulbecco's Modified Eagle Medium (DMEM) for SW1116 Cells
abx703411 500 mL

Dulbecco's Modified Eagle Medium (DMEM) for SW1116 Cells

Sign In for Pricing
View Details