Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL24 Peptide - N-terminal region

RPL24 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RPL24

UniProt

P83731

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL24 Rabbit Polyclonal Antibody (orb327194) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000977

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(2,3-Dioxoindolin-4-yl)ethyl Benzoate
TRC-D915650-250MG 250 mg

2-(2,3-Dioxoindolin-4-yl)ethyl Benzoate

Sign In for Pricing
View Details
BBC3 Polyclonal Antibody
E-AB-67059-01 60 µL

BBC3 Polyclonal Antibody

Sign In for Pricing
View Details
BBC3 Polyclonal Antibody
E-AB-67059-02 120 µL

BBC3 Polyclonal Antibody

Sign In for Pricing
View Details
BBC3 Polyclonal Antibody
E-AB-67059-03 200 µL

BBC3 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS709763 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
COPS8 Rabbit Polyclonal Antibody
ER2001-29 100 µL

COPS8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details