DMRT1 Peptide - middle region
DMRT1 Peptide - middle region
Product Specifications
Product Name Alternative
DMRT1
UniProt
H3BN61
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DMRT1 Rabbit Polyclonal Antibody (orb573711) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC473439-100 1x 100 µL
Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
