PXN Peptide - N-terminal region
PXN Peptide - N-terminal region
Product Specifications
Product Name Alternative
PXN
UniProt
E7EMK8
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PXN Rabbit Polyclonal Antibody (orb587917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005253974
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ADGERCWAAGWPRDGGRSSPGGQDEGGGSWPLEEVVLLVSISSSVQEGEK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P033-740-1ML 1x 1 mL
Biotin Recombinant Monoclonal Mouse Antibody (rBN-34), CF®740 Conjugate - Biotium Choice
Sign In for Pricing
View Details 
![APC Anti-Human CD32 Antibody[IV-3]](https://cdn.genprice.uk/products/763/68dd14a8061270361e7d1f08/imageurl/e-ab-f1075e.webp)
ICH2244-50mg 50 mg
Rat IgG2a (1-1) In Vivo Isotype Control Low Endotoxin
Sign In for Pricing
View Details