Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPREB3 Peptide - middle region

VPREB3 Peptide - middle region

Product Specifications

Product Name Alternative

VPREB3, UNQ355/PRO619

UniProt

Q9UKI3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VPREB3 Rabbit Polyclonal Antibody (orb331348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037510

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNA

More Discoveries

Explore Other Products

Browse additional items from our catalog

pUC18-mini-Tn7T-Plac-dCas9 (Plac) Plasmid
PVT14547 2 µg

pUC18-mini-Tn7T-Plac-dCas9 (Plac) Plasmid

Sign In for Pricing
View Details
HnRNP A2B1 (hnRNPA2, hnRNPB1, Heterogeneous Nuclear Ribonucleoprotein A2B1) (Biotin) discontinued
031032-Biotin 200 µL

HnRNP A2B1 (hnRNPA2, hnRNPB1, Heterogeneous Nuclear Ribonucleoprotein A2B1) (Biotin) discontinued

Sign In for Pricing
View Details
Bovine Thrombospondin 1 (THBS1) ELISA Kit
BSKB65564-01 48 Tests

Bovine Thrombospondin 1 (THBS1) ELISA Kit

Sign In for Pricing
View Details
Bovine Thrombospondin 1 (THBS1) ELISA Kit
BSKB65564-02 96 Tests

Bovine Thrombospondin 1 (THBS1) ELISA Kit

Sign In for Pricing
View Details
TCEAL8
CSB-CL818261HU 10 μg Plasmid + 200 μL Glycerol

TCEAL8

Sign In for Pricing
View Details
E3 Ligase Ligand-linker Conjugate 190
HY-176443 1 Each

E3 Ligase Ligand-linker Conjugate 190

Sign In for Pricing
View Details