Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCD5 Peptide - middle region

SCD5 Peptide - middle region

Product Specifications

Product Name Alternative

SCD5, ACOD4, SCD4

UniProt

Q86SK9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCD5 Rabbit Polyclonal Antibody (orb587872) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079182

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEPP-46 (ML265)
C12586-01 5 mg

TEPP-46 (ML265)

Sign In for Pricing
View Details
TEPP-46 (ML265)
C12586-02 10 mM / 1 mL

TEPP-46 (ML265)

Sign In for Pricing
View Details
TEPP-46 (ML265)
C12586-03 25 mg

TEPP-46 (ML265)

Sign In for Pricing
View Details
TEPP-46 (ML265)
C12586-04 100 mg

TEPP-46 (ML265)

Sign In for Pricing
View Details
TEPP-46 (ML265)
C12586-05 1 g

TEPP-46 (ML265)

Sign In for Pricing
View Details
(αR) ​-α-​Amino-2-pyridinepropanoic Acid
469576-01 500 mg

(αR) ​-α-​Amino-2-pyridinepropanoic Acid

Sign In for Pricing
View Details