Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALX3 Peptide - C-terminal region

ALX3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALX3

UniProt

O95076

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALX3 Rabbit Polyclonal Antibody (orb576106) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006483

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAAHPGIYSIHGFPPTLGGHSFEPSSDGDYKSPSLVSLRVKPKEPPGLLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYR61 ORF Vector (Human) (pORF)
ORF002894 1.0 µg DNA

CYR61 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
GTF3C5 Human shRNA Plasmid Kit (Locus ID 9328)
TR320613 1 Kit

GTF3C5 Human shRNA Plasmid Kit (Locus ID 9328)

Sign In for Pricing
View Details
H-Leu-OH
4030792.1000 1 Kg

H-Leu-OH

Sign In for Pricing
View Details
Human Thrombomodulin (TM) ELISA Kit
DLR-TM-Hu-48T 48 Tests

Human Thrombomodulin (TM) ELISA Kit

Sign In for Pricing
View Details
Msi2 Monoclonal Antibody
UB-GEN-976 100 µL

Msi2 Monoclonal Antibody

Sign In for Pricing
View Details
RAB3C Rabbit Polyclonal Antibody (FITC)
orb2092593 100 µL

RAB3C Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details