Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB3C Rabbit Polyclonal Antibody (FITC)

RAB3C Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q96E17

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDII

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_612462

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV tag Rabbit Polyclonal Antibody (AP)
orb964437 100 µL

HSV tag Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
TargetSeq One® Hyb & Wash Kit v2.0 with Eco Universal Blocking Oligo (for Illumina)
C10832-01 96 Reactions

TargetSeq One® Hyb & Wash Kit v2.0 with Eco Universal Blocking Oligo (for Illumina)

Sign In for Pricing
View Details
TargetSeq One® Hyb & Wash Kit v2.0 with Eco Universal Blocking Oligo (for Illumina)
C10832-02 96 Reactions

TargetSeq One® Hyb & Wash Kit v2.0 with Eco Universal Blocking Oligo (for Illumina)

Sign In for Pricing
View Details
IQGAP1 (IQ Motif Containing GTPase Activating Protein 1, SAR1, p195, HUMORFA01, KIAA0051)
321040-01 50 µg

IQGAP1 (IQ Motif Containing GTPase Activating Protein 1, SAR1, p195, HUMORFA01, KIAA0051)

Sign In for Pricing
View Details
IQGAP1 (IQ Motif Containing GTPase Activating Protein 1, SAR1, p195, HUMORFA01, KIAA0051)
321040-02 100 µg

IQGAP1 (IQ Motif Containing GTPase Activating Protein 1, SAR1, p195, HUMORFA01, KIAA0051)

Sign In for Pricing
View Details
Chondroitin sulfate Synthase 3 (CHSY3) Human ELISA Kit
C3530 96 Tests

Chondroitin sulfate Synthase 3 (CHSY3) Human ELISA Kit

Sign In for Pricing
View Details