Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QL3 Peptide - middle region

C1QL3 Peptide - middle region

Product Specifications

Product Name Alternative

C1QL3, CTRP13

UniProt

Q5VWW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1QL3 Rabbit Polyclonal Antibody (orb586935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010908

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Jun (Phospho-Ser73) Antibody
E011003 100 µg -100 µL

C-Jun (Phospho-Ser73) Antibody

Sign In for Pricing
View Details
Human FGF3 mRNA
HY-174697 500 µg

Human FGF3 mRNA

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to HSP90AB1
MAB-606030227 0.1ml

Mouse Monoclonal Antibody to HSP90AB1

Sign In for Pricing
View Details
Recombinant Mouse Brain-specific serine protease 4 (Prss22)
CSB-EP880636MO-01 10 µg

Recombinant Mouse Brain-specific serine protease 4 (Prss22)

Sign In for Pricing
View Details
Recombinant Mouse Brain-specific serine protease 4 (Prss22)
CSB-EP880636MO-02 50 µg

Recombinant Mouse Brain-specific serine protease 4 (Prss22)

Sign In for Pricing
View Details
Recombinant Mouse Brain-specific serine protease 4 (Prss22)
CSB-EP880636MO-03 200 µg

Recombinant Mouse Brain-specific serine protease 4 (Prss22)

Sign In for Pricing
View Details