Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Brain-specific serine protease 4 (Prss22)

Product Specifications

Product Name Alternative

Serine protease 22 (Serine protease 26) (Tryptase epsilon) (Bssp4) (Prss26)

Abbreviation

Recombinant Mouse Prss22 protein

Gene Name

Prss22

UniProt

Q9ER10

Expression Region

33-306aa

Organism

Mus musculus (Mouse)

Target Sequence

ATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSHHCAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRYSWKEGTHADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGEGCADDRPGVYTSLLAHRSWVQRIVQGVQLRGYLADSGDTGSS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.9 kDa

References & Citations

"Mouse chromosome 17A3.3 contains 13 genes that encode functional tryptic-like serine proteases with distinct tissue and cell expression patterns." Wong G.W., Yasuda S., Morokawa N., Li L., Stevens R.L. J. Biol. Chem. 279:2438-2452 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-2 Antibody
F47585-0.08ML 0.08 mL

Bcl-2 Antibody

Sign In for Pricing
View Details
Polystyrene AM HMPA
H10015.5G 5 g

Polystyrene AM HMPA

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/451), CF594 conjugate, 0.1mg/mL
BNC940451-500 1x 500 µL

HER-2 / CD340 (HRB2/451), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF740 conjugate, 0.1mg/mL
BNC741920-100 1x 100 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acetylcholinesterase (ACHE) (NM_000665) Human Over-expression Lysate
LY424577 100 µg

Acetylcholinesterase (ACHE) (NM_000665) Human Over-expression Lysate

Sign In for Pricing
View Details
ALPI Rabbit Polyclonal Antibody
TA397020S 25 µL

ALPI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details