Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G4B Peptide - C-terminal region

PLA2G4B Peptide - C-terminal region

Product Specifications

Product Name Alternative

HsT16992, cPLA2-beta

UniProt

P0C869

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLA2G4B Rabbit Polyclonal Antibody (orb324760) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005081

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLTHYNVCNNQEQLLEALR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Mouse Anti-Zika Virus NS1-Monoclonal
MBS560978-01 1 mg

Purified Mouse Anti-Zika Virus NS1-Monoclonal

Sign In for Pricing
View Details
Purified Mouse Anti-Zika Virus NS1-Monoclonal
MBS560978-02 5x 1 mg

Purified Mouse Anti-Zika Virus NS1-Monoclonal

Sign In for Pricing
View Details
Human Oral Squamous Cell Carcinoma Cells [WSU-HN30]
AFG-ELL-1939 > 1x 10^6 Cells / Vial

Human Oral Squamous Cell Carcinoma Cells [WSU-HN30]

Sign In for Pricing
View Details
AMFR Antibody - C-terminal region : Biotin (ARP42995_T100-Biotin)
ARP42995_T100-Biotin 100 µL

AMFR Antibody - C-terminal region : Biotin (ARP42995_T100-Biotin)

Sign In for Pricing
View Details
Ɑ-Hydroxy-ω-Azido PEG
135000-00-5.1G 1 g

Ɑ-Hydroxy-ω-Azido PEG

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv.trifolii Proline--tRNA ligase (proS)
MBS1167058-01 0.02 mg (E-Coli)

Recombinant Rhizobium leguminosarum bv.trifolii Proline--tRNA ligase (proS)

Sign In for Pricing
View Details