Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG9 Peptide - middle region

ALG9 Peptide - middle region

Product Specifications

Product Name Alternative

ALG9, DIBD1

UniProt

Q9H6U8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG9 Rabbit Polyclonal Antibody (orb579365) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLVLPLTSLMEYLLQRFHVQNLGHPYWLTLAPMYIWFIIFFIQPHKEERF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JunD (V249) polyclonal antibody
BS1198-01 50 µL

JunD (V249) polyclonal antibody

Sign In for Pricing
View Details
JunD (V249) polyclonal antibody
BS1198-02 100 µL

JunD (V249) polyclonal antibody

Sign In for Pricing
View Details
Comb for 4 samples, 2 markers, 1.5 mm thick
CGMD4-1.5 1 Unit

Comb for 4 samples, 2 markers, 1.5 mm thick

Sign In for Pricing
View Details
Recombinant Human Tumor suppressor candidate 5 (TUSC5)
orb2930432-01 20 µg

Recombinant Human Tumor suppressor candidate 5 (TUSC5)

Sign In for Pricing
View Details
Recombinant Human Tumor suppressor candidate 5 (TUSC5)
orb2930432-02 100 µg

Recombinant Human Tumor suppressor candidate 5 (TUSC5)

Sign In for Pricing
View Details
Recombinant Human ADSL Protein, N-His
orb3061929-01 50 µg

Recombinant Human ADSL Protein, N-His

Sign In for Pricing
View Details