Recombinant Human Tumor suppressor candidate 5 (TUSC5)
This Recombinant Human Tumor suppressor candidate 5 (TUSC5) spans the amino acid sequence from region 1-177.
Product Specifications
Product Name Alternative
Tumor suppressor candidate 5, Interferon-induced transmembrane domain-containing protein D3, Protein located at seventeen-p-thirteen point three 1
UniProt
Q8IXB3
Expression Region
1-177
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGL PFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLN LIPLIISIMSRSSMQQGNVDGARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042040-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681098-500 1x 500 µL
Cyclin B1 (CCNB1/1098), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details