METTL16 Peptide - middle region
METTL16 Peptide - middle region
Product Specifications
Product Name Alternative
METT10D
UniProt
Q86W50
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with METTL16 Rabbit Polyclonal Antibody (orb325358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_076991
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QGRTMRWALAWSFYDDVTVPSPPSKRRKLEKPRKPITFVVLASVMKELSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15313124 1 Vial
Lentiviral human HAUS6 shRNA (UAS) - Lentiviral human HAUS6 shRNA (UAS) (25)
Sign In for Pricing
View Details 
38926156 3x 1.0 µg DNA
RGD1305089 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
Sign In for Pricing
View Details