Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS33 Peptide - middle region

MRPS33 Peptide - middle region

Product Specifications

Product Name Alternative

S33mt, PTD003, CGI-139, MRP-S33

UniProt

Q9Y291

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS33 Rabbit Polyclonal Antibody (orb583677) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444263

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDOR1 Double Nickase Plasmid (m)
sc-429717-NIC 20 µg

NDOR1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Recombinant Human PPEF1, GST-tagged
PPEF1-1878H 25 µg

Recombinant Human PPEF1, GST-tagged

Sign In for Pricing
View Details
Recombinant Human Interleukin-2 (rHuIL-2)
orb1495078-01 1 mg

Recombinant Human Interleukin-2 (rHuIL-2)

Sign In for Pricing
View Details
Recombinant Human Interleukin-2 (rHuIL-2)
orb1495078-02 10 µg

Recombinant Human Interleukin-2 (rHuIL-2)

Sign In for Pricing
View Details
Recombinant Human Interleukin-2 (rHuIL-2)
orb1495078-03 50 µg

Recombinant Human Interleukin-2 (rHuIL-2)

Sign In for Pricing
View Details
C1QL2 Blocking Peptide
CBP5203-01 1 mg

C1QL2 Blocking Peptide

Sign In for Pricing
View Details