SETD4 Peptide - C-terminal region
SETD4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
SETD4, C21orf18, C21orf27
UniProt
Q9NVD3
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SETD4 Rabbit Polyclonal Antibody (orb583844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_006724084
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NAVLQKVSHMKDEKEALINQLTLVESLWTEELKILRASAETLHSLQTAFT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![GPC3 Rabbit Monoclonal Antibody [Clone ID: 15G1]](https://cdn.genprice.uk/products/937/68dd1b5f061270361ea11af5/imageurl/ta399834.webp)
73520 15 Preparations
EXTRAClean Urine Exosome and Free-Circulating RNA Isolation Maxi Kit
Sign In for Pricing
View Details 
