Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF5 Peptide - C-terminal region

RNF5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RNF5, G16, NG2, RMA1

UniProt

Q99942

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF5 Rabbit Polyclonal Antibody (orb583907) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008844

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Selenoprotein S (SELS), partial
orb3007415-01 20 µg

Recombinant Human Selenoprotein S (SELS), partial

Sign In for Pricing
View Details
Recombinant Human Selenoprotein S (SELS), partial
orb3007415-02 100 µg

Recombinant Human Selenoprotein S (SELS), partial

Sign In for Pricing
View Details
Recombinant Human Selenoprotein S (SELS), partial
orb3007415-03 1 mg

Recombinant Human Selenoprotein S (SELS), partial

Sign In for Pricing
View Details
Human Cytochrome P450 1B1 (CYP1B1) ELISA Kit
DLR-CYP1B1-Hu-48T 48 Tests

Human Cytochrome P450 1B1 (CYP1B1) ELISA Kit

Sign In for Pricing
View Details
Monoclonal Antibody to Lipase, Hepatic (LIPC)
TRV-0034608-01 20 µL

Monoclonal Antibody to Lipase, Hepatic (LIPC)

Sign In for Pricing
View Details
Monoclonal Antibody to Lipase, Hepatic (LIPC)
TRV-0034608-02 100 µL

Monoclonal Antibody to Lipase, Hepatic (LIPC)

Sign In for Pricing
View Details