Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein S (SELS), partial

This Recombinant Human Selenoprotein S (SELS), partial spans the amino acid sequence from region 49-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein S; SelS; VCP-interacting membrane protein; SELENOS SELS VIMP AD-015 SBBI8

UniProt

Q9BQE4

Expression Region

49-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPH1 Protein Vector (Rat) (pPB-C-His)
PV264762 500 ng

DPH1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Titanium nitride, 99%
GX6013-50g 50 g

Titanium nitride, 99%

Sign In for Pricing
View Details
TRNAK32 CRISPR All-in-one AAV vector set (with saCas9)(Human)
48129151 3x 1.0 µg DNA

TRNAK32 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
RDX Protein Vector (Human) (pPM-C-HA)
38777021 500 ng

RDX Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Amylin (Rat, Mouse) - I-125 Labeled
T-017-11 10 µCi

Amylin (Rat, Mouse) - I-125 Labeled

Sign In for Pricing
View Details
TRNAT4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV754134 1.0 µg DNA

TRNAT4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details