Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGRMC2 Peptide - C-terminal region

PGRMC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DG6, PMBP

UniProt

O15173

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGRMC2 Rabbit Polyclonal Antibody (orb327253) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicanine
E8089-1mg 1 mg

Chicanine

Sign In for Pricing
View Details
EP4 Antagonist 14
orb1980027-01 1 mg

EP4 Antagonist 14

Sign In for Pricing
View Details
EP4 Antagonist 14
orb1980027-02 5 mg

EP4 Antagonist 14

Sign In for Pricing
View Details
EP4 Antagonist 14
orb1980027-03 10 mg

EP4 Antagonist 14

Sign In for Pricing
View Details
Ethyl 2-amino-4-cyclopropyl-1,3-oxazole-5-carboxylate
KHD06222-01 50 mg

Ethyl 2-amino-4-cyclopropyl-1,3-oxazole-5-carboxylate

Sign In for Pricing
View Details
Ethyl 2-amino-4-cyclopropyl-1,3-oxazole-5-carboxylate
KHD06222-02 0.5 g

Ethyl 2-amino-4-cyclopropyl-1,3-oxazole-5-carboxylate

Sign In for Pricing
View Details