CBR3 Peptide - middle region
CBR3 Peptide - middle region
Product Specifications
Product Name Alternative
CBR3
UniProt
O75828
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CBR3 Rabbit Polyclonal Antibody (orb330449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001227
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDL
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1215266 Inquire
Recombinant Musca domestica Armadillo segment polarity protein (arm), partial
Sign In for Pricing
View Details 
E-PP-0635-01 1 mg
Aldosterone Secretion Inhibiting Factor (1-35), bovine
Sign In for Pricing
View Details 
E-PP-0635-02 10 mg
Aldosterone Secretion Inhibiting Factor (1-35), bovine
Sign In for Pricing
View Details