APOC2 Peptide - middle region
APOC2 Peptide - middle region
Product Specifications
Product Name Alternative
APOC2, APC2
UniProt
P02655
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with APOC2 Rabbit Polyclonal Antibody (orb582283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000474
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLK
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6420610-01 0.1 mL
Histone H3.1 (HIST1H3J, Histone H3K36me3, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, Histone H3/k, Histone H3/l, HIST3H3) (PE)
Sign In for Pricing
View Details MBS6420610-02 5x 0.1 mL
Histone H3.1 (HIST1H3J, Histone H3K36me3, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, Histone H3/k, Histone H3/l, HIST3H3) (PE)
Sign In for Pricing
View Details 
248473-APC 100 µL
MAP4K4 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4, FLH21957, FLJ10410, FLJ20373, FLJ90111, HGK, KIAA0687, NIK) (APC)
Sign In for Pricing
View Details