SGK2 Peptide - N-terminal region
SGK2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
SGK2
UniProt
Q9HBY8
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SGK2 Rabbit Polyclonal Antibody (orb588466) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PELPDHCYRMNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6459810-01 0.1 mL
TMPRSS11D (Transmembrane Protease Serine 11D, 3421-, Airway Trypsin-like Protease, Transmembrane Protease Serine 11D non-Catalytic chain, Transmembrane Protease Serine 11D Catalytic Chain, TMPRSS11D, HAT) (MaxLight 550)
Sign In for Pricing
View Details MBS6459810-02 5x 0.1 mL
TMPRSS11D (Transmembrane Protease Serine 11D, 3421-, Airway Trypsin-like Protease, Transmembrane Protease Serine 11D non-Catalytic chain, Transmembrane Protease Serine 11D Catalytic Chain, TMPRSS11D, HAT) (MaxLight 550)
Sign In for Pricing
View Details