SPAG5 Peptide - N-terminal region
SPAG5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
SPAG5
UniProt
Q96R06
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPAG5 Rabbit Polyclonal Antibody (orb588473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006452
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSTCLTPNLVEMESQEAPGPAVEDVGRILGSDTESWMSPLAWLEKGVNTS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY422766 100 µg
SLC27A6 (NM_001017372) Human Over-expression Lysate
Sign In for Pricing
View Details ![Phospho-Smad1/5/9 (S463/S465/S467) Recombinant Rabbit Monoclonal Antibody [JE59-46]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea8160c/imageurl/ha722566.webp)
HA722566 100 µL
Phospho-Smad1/5/9 (S463/S465/S467) Recombinant Rabbit Monoclonal Antibody [JE59-46]
Sign In for Pricing
View Details 
LY426542 100 µg
Endothelin B Receptor (EDNRB) (NM_001122659) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC742278-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![PE/Cyanine5 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody[RB6-8C5]](https://cdn.genprice.uk/products/763/68dd14a8061270361e7d1f0d/imageurl/e-ab-f1120g.webp)
E-AB-F1120G-01 50 Tests
PE/Cyanine5 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody[RB6-8C5]
Sign In for Pricing
View Details