Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNPO Peptide - C-terminal region

SYNPO Peptide - C-terminal region

Product Specifications

Product Name Alternative

SYNPO, KIAA1029

UniProt

Q8N3V7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYNPO Rabbit Polyclonal Antibody (orb588479) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSSHTPELAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PITX2 (NM_153426) Human Tagged ORF Clone Lentiviral Particle
RC213218L3V 200 µL

PITX2 (NM_153426) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Death-associated protein Kinase 3 (DAPK3) Human ELISA Kit
C8322 96 Tests

Death-associated protein Kinase 3 (DAPK3) Human ELISA Kit

Sign In for Pricing
View Details
Neil1 Rat siRNA Oligo Duplex (Locus ID 367090)
SR508533 1 Kit

Neil1 Rat siRNA Oligo Duplex (Locus ID 367090)

Sign In for Pricing
View Details
CDC42 Rabbit Polyclonal Antibody (Fluoro594)
orb3120010 100 µg

CDC42 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Recombinant JAK1 (438-1154) Protein
B2017653 10 µg

Recombinant JAK1 (438-1154) Protein

Sign In for Pricing
View Details
Shmt2 ORF Vector (Mouse) (pORF)
ORF057265 1.0 µg DNA

Shmt2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details