Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YBX3 Peptide - C-terminal region

YBX3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CSDA, DBPA, CSDA1, ZONAB

UniProt

P16989

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YBX3 Rabbit Polyclonal Antibody (orb327332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ARID3B Antibody [Alexa Fluor 594]
NBP1-30456AF594 0.1 mL

Rabbit Polyclonal ARID3B Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Anti-Human CD19 Therapeutic Antibody
TRI-AB-058 0.1mg

Anti-Human CD19 Therapeutic Antibody

Sign In for Pricing
View Details
SPRP Protein Vector (Human) (pPB-N-His)
PV039974 500 ng

SPRP Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Goat anti-AKT2 Antibody
dAP-2580 50 µg

Goat anti-AKT2 Antibody

Sign In for Pricing
View Details
GST-tag polyclonal antibody
BS67272-01 50 µL

GST-tag polyclonal antibody

Sign In for Pricing
View Details
GST-tag polyclonal antibody
BS67272-02 100 µL

GST-tag polyclonal antibody

Sign In for Pricing
View Details