Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACY1 Peptide - middle region

ACY1 Peptide - middle region

Product Specifications

Product Name Alternative

ACY1

UniProt

Q03154

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACY1 Rabbit Polyclonal Antibody (orb588553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001185827

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSH Receptor (TSHR) (NM_000369) Human Tagged Lenti ORF Clone
RC220499L4 10 µg

TSH Receptor (TSHR) (NM_000369) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Bacillus phage SP02 DNA polymerase (L), partial
MBS1162569 Inquire

Recombinant Bacillus phage SP02 DNA polymerase (L), partial

Sign In for Pricing
View Details
LCAT Antibody
MBS8594097-01 0.1 mg

LCAT Antibody

Sign In for Pricing
View Details
LCAT Antibody
MBS8594097-02 0.1 mL (AF405L)

LCAT Antibody

Sign In for Pricing
View Details
LCAT Antibody
MBS8594097-03 0.1 mL (AF405S)

LCAT Antibody

Sign In for Pricing
View Details
LCAT Antibody
MBS8594097-04 0.1 mL (AF610)

LCAT Antibody

Sign In for Pricing
View Details