Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKS1B Peptide - N-terminal region

CKS1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

CKS1, ckshs1, PNAS-16, PNAS-18

UniProt

P61024

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKS1B Rabbit Polyclonal Antibody (orb588571) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001817

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Egln3 Polyclonal Antibody, Biotin Conjugated
A52094-050 50 µL

Egln3 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
ICOS Ligand (ICOSLG) Mouse Monoclonal Antibody [Clone ID: LBI2C5]
AMM18579V 100 µL

ICOS Ligand (ICOSLG) Mouse Monoclonal Antibody [Clone ID: LBI2C5]

Sign In for Pricing
View Details
rno-miR-337-3p miRNA Agomir
MBS8315207-01 5 nmol

rno-miR-337-3p miRNA Agomir

Sign In for Pricing
View Details
rno-miR-337-3p miRNA Agomir
MBS8315207-02 10 nmol

rno-miR-337-3p miRNA Agomir

Sign In for Pricing
View Details
rno-miR-337-3p miRNA Agomir
MBS8315207-03 20 nmol

rno-miR-337-3p miRNA Agomir

Sign In for Pricing
View Details
rno-miR-337-3p miRNA Agomir
MBS8315207-04 5x 20 nmol

rno-miR-337-3p miRNA Agomir

Sign In for Pricing
View Details