Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNA3 Peptide - N-terminal region

EFNA3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EFNA3, EFL2, EPLG3, LERK3

UniProt

P52797

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFNA3 Rabbit Polyclonal Antibody (orb588588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004943

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIP3 Recombinant Rabbit Monoclonal Antibody [PSH04-78]
HA722182 100 µL

RIP3 Recombinant Rabbit Monoclonal Antibody [PSH04-78]

Sign In for Pricing
View Details
SYK (NM_003177) Human Over-expression Lysate
LY401101 100 µg

SYK (NM_003177) Human Over-expression Lysate

Sign In for Pricing
View Details
Tekt3 Mouse Gene Knockout Kit (CRISPR)
KN517400 1 Kit

Tekt3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rel B (RELB) Human Gene Knockout Kit (CRISPR)
KN207006LP 1 Kit

Rel B (RELB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MMP9 (Matrix Metalloproteinase 9) (2C3), Biotin conjugate, 0.1mg/mL
BNCB1764-100 1x 100 µL

MMP9 (Matrix Metalloproteinase 9) (2C3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (A103), CF647 conjugate, 0.1mg/mL
BNC470668-500 1x 500 µL

MART-1 / Melan-A (A103), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details