EYA2 Peptide - middle region
EYA2 Peptide - middle region
Product Specifications
Product Name Alternative
EYA2, EAB1
UniProt
O00167
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EYA2 Rabbit Polyclonal Antibody (orb588598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_742108
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTT
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb3005165-01 20 µg
Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial
Sign In for Pricing
View Details 
orb3005165-02 100 µg
Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial
Sign In for Pricing
View Details 
orb3005165-03 1 mg
Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial
Sign In for Pricing
View Details 
V5800SAF-100UG 100 µg
MtTFA Antibody | Mitochondrial transcription factor 1 / TFAM
Sign In for Pricing
View Details