Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial

This Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial spans the amino acid sequence from region 124-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 5; Polyposis locus protein 1; Protein TB2; REEP5 C5orf18 DP1 TB2

UniProt

Q00765

Expression Region

124-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TR1 (Tomoregulin 1, TMEFF1, CT120.1, C9orf2, Transmembrane Protein With EGF-Like And Two Follistatin-Like Domains 1, Cancer/Testis Antigen Family 120, Member 1)
365426 200 µL

TR1 (Tomoregulin 1, TMEFF1, CT120.1, C9orf2, Transmembrane Protein With EGF-Like And Two Follistatin-Like Domains 1, Cancer/Testis Antigen Family 120, Member 1)

Sign In for Pricing
View Details
CD19 (AP) discontinued
C2269-51-AP 100 µL

CD19 (AP) discontinued

Sign In for Pricing
View Details
ESD (NM_001984) Human Tagged ORF Clone
RC200533 10 µg

ESD (NM_001984) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human TACC2 shRNA (UAS) - Lentiviral human TACC2 shRNA (UAS, iRFP) (100)
GTR15134835 1 Vial

Lentiviral human TACC2 shRNA (UAS) - Lentiviral human TACC2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CACNA2D1 Protein Vector (Mouse) (pPB-C-His)
PV160858 500 ng

CACNA2D1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
ALX3 Antibody
orb686001-01 50 μL

ALX3 Antibody

Sign In for Pricing
View Details