Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPTX1 Peptide - middle region

NPTX1 Peptide - middle region

Product Specifications

Product Name Alternative

NP1

UniProt

Q15818

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002513.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI10B1]
CF812568 100 µg

TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI10B1]

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/1748), CF568 conjugate, 0.1mg/mL
BNC681748-500 1x 500 µL

Ubiquitin (Autophagy Marker) (UBB/1748), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NFIB / NF1B2 Recombinant Rabbit Monoclonal Antibody [JE35-21]
HA721879 100 µL

NFIB / NF1B2 Recombinant Rabbit Monoclonal Antibody [JE35-21]

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rBP53-12), 0.2mg/mL
BNUB2094-500 1x 500 µL

P53 Tumor Suppressor Protein (rBP53-12), 0.2mg/mL

Sign In for Pricing
View Details
OR4A47 (NM_001005512) Human Over-expression Lysate
LC423615 20 µg

OR4A47 (NM_001005512) Human Over-expression Lysate

Sign In for Pricing
View Details
TRMT61B antibody
FNab09009 100 µg

TRMT61B antibody

Sign In for Pricing
View Details