Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGAM1 Peptide - middle region

PGAM1 Peptide - middle region

Product Specifications

Product Name Alternative

PGAMA, PGAM-B, HEL-S-35

UniProt

P18669

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002620.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP1A Rabbit Polyclonal Antibody (BF750)
orb1578427 100 µL

MAP1A Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Pyracrenic acid
HY-130294 1 Each

Pyracrenic acid

Sign In for Pricing
View Details
CD117/C-Kit BioAssayTM ELISA Kit (Mouse)
396612 96 Tests

CD117/C-Kit BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
(Trinbelimab) Biosimilar Reference Antibody
orb3159020-01 100 µg

(Trinbelimab) Biosimilar Reference Antibody

Sign In for Pricing
View Details
(Trinbelimab) Biosimilar Reference Antibody
orb3159020-02 1 mg

(Trinbelimab) Biosimilar Reference Antibody

Sign In for Pricing
View Details
(Trinbelimab) Biosimilar Reference Antibody
orb3159020-03 5 mg

(Trinbelimab) Biosimilar Reference Antibody

Sign In for Pricing
View Details